PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco013327.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family TALE
Protein Properties Length: 638aa    MW: 69689.9 Da    PI: 6.7794
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco013327.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.82.1e-094685051954
                  HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
     Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                  Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  Aco013327.1 468 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 505
                  664459******************************88 PP

2BELL82.55.2e-273463962272
         BELL  22 rYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                  rY+ y+ q+q+v++sF+ v+g g+a+pYt lA+ka+SrhFrcLkdaia q+
  Aco013327.1 346 RYNNYCGQMQMVVNSFDSVMGFGAAAPYTGLAQKAMSRHFRCLKDAIAAQL 396
                  9***********************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.6E-40270394IPR006563POX domain
PfamPF075262.4E-31276393IPR006563POX domain
PROSITE profilePS5007112.536446509IPR001356Homeobox domain
CDDcd000861.45E-12449510No hitNo description
SMARTSM003892.5E-9449513IPR001356Homeobox domain
SuperFamilySSF466893.59E-17451516IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.4E-28452515IPR009057Homeodomain-like
PfamPF059203.1E-18466505IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 638 aa     Download sequence    Send to blast
MSHGFHHHGG GFSFSDGFDR SVTRQGQQQH HVAQQSRRDK LRLQQQQQQQ QGFVDPALLP  60
IEEEEEEGED QDSAIYEPTG AAPGPLLLQR QQPGGHQYWY SASNQLGSIL TTAANLGSLG  120
EPNSSNKPSG LSSDSMQLFL MNPQPHRQQQ QHARSSPPSP PQSLHHHHHQ TLIPGFGDNA  180
SSFGGGGGGV VEGQALSLSL SSSLQQFELR KAEDHFRLRE GLVYINNQQQ QQQLQQQQQQ  240
QQNNPILQLQ QSHGQQLGQA HHLQMGYGPM GVANLLRNSK YARPVQELLE EFCSVGREQL  300
KGDRLRALRG SGGSSSSNPK ANNPSSSTAP ATASSSSSKD QLPPLRYNNY CGQMQMVVNS  360
FDSVMGFGAA APYTGLAQKA MSRHFRCLKD AIAAQLRHTC ELLGEKDAAG GAAGGVTKGE  420
TPRLRLLDQR LRQQRAFHQM GGMMEQEAWR PQRGLPERSV TILRAWLFEH FLHPYPSDAD  480
KHLLARQTGL SRNQVSNWFI NARVRLWKPM VEEMYQQEEK EEGDNTTQHS DPTAADPNAN  540
ADGNAAAQSR ESLSPPGVAH VDDSVDLDIA VDPSPPPELF GGAADDVYVH RYGWGPAAAQ  600
ARVGPTGDVS LTLGLRHAGG NVNESGVPFS LRDHFGA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_B1e-15455513563Homeobox protein Meis2
3k2a_A1e-15455513563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM6668971e-163KM666897.1 Ananas bracteatus clone 52295c microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008813264.11e-166PREDICTED: BEL1-like homeodomain protein 4
SwissprotQ94KL51e-119BLH4_ARATH; BEL1-like homeodomain protein 4
TrEMBLF2CYW11e-161F2CYW1_HORVD; Predicted protein
STRINGGSMUA_Achr7P27440_0011e-158(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44332945
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-92BEL1-like homeodomain 2